PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.356720.1
Common NameCsa_1G657480, LOC101206605
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 528aa    MW: 58329.7 Da    PI: 6.4544
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.356720.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.5e-3380136259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++C vkkkvers  d++++ei+Y+g Hnh 
  Cucsa.356720.1  80 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCLVKKKVERSL-DGQITEIIYKGAHNHA 136
                     7****************************************.***************7 PP

2WRKY104.27.2e-33268325259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++prsYY+CtsagC v+k+ver+++d k+v++tYeg+Hnhe
  Cucsa.356720.1 268 EDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCLVRKHVERASHDLKCVITTYEGKHNHE 325
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.11274138IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-2877138IPR003657WRKY domain
SuperFamilySSF1182905.62E-2677138IPR003657WRKY domain
SMARTSM007743.3E-3779137IPR003657WRKY domain
PfamPF031064.3E-2580135IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.2E-36252327IPR003657WRKY domain
SuperFamilySSF1182904.84E-28260327IPR003657WRKY domain
PROSITE profilePS5081137.7262327IPR003657WRKY domain
SMARTSM007742.6E-37267326IPR003657WRKY domain
PfamPF031061.3E-24268325IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MVCQDLYDKR IPKCRVIFYF DGKIVNGNCE NMESCLSSIT TNQPCIHEES TQGDDIDTQH  60
PLEDEQKGSY IPMGMLRTSE DGYNWRKYGQ KQVKGSEYPR SYYKCTHPNC LVKKKVERSL  120
DGQITEIIYK GAHNHAKPDP NRRAMAGSVP ISGDNPEIGE GGGNHSKLEA GLTWRNSQYG  180
KTVGVLEPVG TPELSSTLAS HDDDNGGGGD DDLTTQGSIS VCTEADDAEP ELKRRRKEDS  240
SIETNLASRS VREPRVVVQI ETEVDILEDG YRWRKYGQKV VKGNPNPRSY YKCTSAGCLV  300
RKHVERASHD LKCVITTYEG KHNHEVPAAR NSSQVNSGNG NAQPPASHVQ PNMGLSRNSN  360
VPKSETEIQD LATHFYPKPE FNNDYQRSGF DTFTNDMKLG APPFCQMKFP PLRNTLPYST  420
FGLSSKHTAT GISGSLASVV SDFPISLPLN QKLSAAGYDY TNGRPILPFQ VFLAGQQLRE  480
TDRFLTPKQE HDDDNICASF QPVVDSSSGS SSSSISSVYQ QIMGNFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-3380328878Probable WRKY transcription factor 4
2lex_A2e-3380328878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818080.0LN681808.1 Cucumis melo genomic scaffold, anchoredscaffold00012.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011660224.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ6VWJ61e-91WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLA0A0A0M0L10.0A0A0A0M0L1_CUCSA; Uncharacterized protein
STRINGGLYMA09G38581.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83493445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.12e-86WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]